DPCstruct | MC17743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5K0Y0 | 1-82 | MQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVRRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVNPPKE |
| A0A5N5JU26 | 155-239 | PEIHTFHKALKEMFPIEAGDIDPKDRILPKLPAPKWLDSQKSTETRQETLTEYFQSLLNLPSKITHCQLVRNFFKVRPDDESPPA |
| H0YPU9 | 45-133 | None |
| A0A4U1EJA3 | 58-149 | None |
| K1PYY0 | 43-128 | None |
| A0A4W3INF9 | 35-121 | None |
| A0A1X7USB6 | 67-159 | None |
| A0A662YJM6 | 2-80 | None |
| A0A0E9Q4M7 | 2-73 | None |
| A0A7D9I652 | 45-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.