DPCstruct | MC17742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653C6A5 | 62-144 | KKIMPKLTDLGYYNWRSGKVVCNDSSHFKVKQDPSKGLIFQNRFDRKIINPAPGCNPGANTTRKRVYTPMYQLVILFDHVTKV |
| A0A3N0YFA8 | 28-100 | CFYNWGTQVAKHNASSNYEVITENPSGLLFQFKKDLKILNVDPEAIPGDSFIRIPVQSDLYVHVVIYDHITRK |
| A0A1U7UT63 | 163-235 | None |
| A0A1L8HWS6 | 88-161 | None |
| A0A2R6XQ23 | 202-274 | None |
| A0A815NYC2 | 5-90 | None |
| A0A556U836 | 389-460 | None |
| A0A812UWA7 | 849-922 | None |
| A0A5C6N199 | 5-77 | None |
| A0A4C1UZ58 | 11-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.