DPCstruct | MC17741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3187 |
|---|---|
| Mean domain length (aa) | 308 ± 57 aa |
| Standard deviation of domain lengths | 56.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.11 |
| Pfam Score | 73.92 |
| Assigned Pfam label(s) | PF10197- CL0261- PF06644- CL0022- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521SXU1 | 2-244 | NTGNVLLGAGLAFLAAGLYGFVGLRMGRRVFENPEERLAWNAFRTWWLALAAVTALGALPSVAAVLGVRELWLFLSFTIFNLFGTCL… |
| A0A3N0YD02 | 287-628 | RNNNFSTMSRDPPLSDQGETIIGVYLLVLGWLSWFGNSIVIFILFKQRSSLQPTDYLTLNLAISDASISVFGYSRGILEIFNVFKDN… |
| A0A1D2N6D9 | 343-697 | None |
| A0A1D2N8C9 | 196-566 | None |
| A0A1D2NJ48 | 48-341 | None |
| A0A1D2NL70 | 446-780 | None |
| A0A5C6SW17 | 18-352 | None |
| A0A5C6SX55 | 21-364 | None |
| A0A7M3RQM6 | 568-919 | None |
| A0A1I8IT42 | 3-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.