DPCstruct | MC17740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0YBT1 | 1-147 | MLTIQASGWNKRKAENLDRTLAKRYIKTVQRIAEATKDLEKLTAELSLQQDTVQQWVTDVQQWTSGPTIQNDLQRTIEGLYLGIKQR… |
| A0A3S2PND4 | 39-195 | MSKAVRTDMLTIQAIGWNKRKVEKLDLTLAKRYIKTVQRISEASADLGKLTQDLSIQEDMVQQWVSDVKEWAAEPTGHNDLEKTIEG… |
| A0A498M3P7 | 2-121 | None |
| A0A6P6K331 | 3-121 | None |
| A0A498N0A1 | 2-121 | None |
| A0A498P2T3 | 293-427 | None |
| A0A6P8V784 | 37-199 | None |
| A0A6P6PFG7 | 8-150 | None |
| A0A498LZA1 | 298-424 | None |
| A0A6P6MWL3 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.