DPCstruct | MC17735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 968 |
|---|---|
| Mean domain length (aa) | 117 ± 26 aa |
| Standard deviation of domain lengths | 25.98 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 98.24 |
| Assigned Pfam label(s) | CL0020- CL0428- CL0287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9T1L6 | 2-90 | WTLKHATKPIYPKAALIAKQTGCARFVITIDNQGNTIDIRFVESFPEGLFVDVSRESLKSWQWQASAGNSESQAIIRTVQLDYFMKE… |
| A0A1U7LEM5 | 24-144 | ATPVMALDRDVRLMDEDTTIMVVAEVQPEFNGNLNQWIGENVQYPEEAYANQIDGRVFVTFVIEKDGVVSHVRVVRSAHPLLDAEAL… |
| A0A7C8KKK4 | 37-182 | None |
| A0A538QF01 | 616-759 | None |
| A0A3D3P1F8 | 144-328 | None |
| A0A355IRC8 | 243-376 | None |
| C6XMD6 | 144-240 | None |
| A0A5Q4FQQ3 | 15-117 | None |
| A0A154NBA3 | 46-159 | None |
| A0A7Y4ZPU5 | 145-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.