DPCstruct | MC1773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 240 |
|---|---|
| Mean domain length (aa) | 243 ± 58 aa |
| Standard deviation of domain lengths | 58.26 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.52 |
| Pfam Score | 40.22 |
| Assigned Pfam label(s) | PF07773- PF21203- PF02990- PF09773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IK29 | 136-358 | TVQTSEHLHRGHELGEPLPIECLTPDRTSWEPMPCRDRQEPVVVRFGVDTAFHCSWLLDTDAVYALVRDAVAMQRSIHCRVPLDNER… |
| K0KWK0 | 30-253 | IPFQKGESLPISCISRNIDNGEHKFDEKDNIIYESFPVCQETGEPFTLKYGESGVKNCTITLTDEIYHLFQLYIHQDVPFSCRLPYS… |
| A0A6J0J7X1 | 29-246 | None |
| A0A287A243 | 572-772 | None |
| G0P2Y5 | 25-238 | None |
| A0A7J6D3I9 | 435-649 | None |
| F4Q874 | 307-550 | None |
| A0A654HUA8 | 12-237 | None |
| W5MFJ9 | 250-464 | None |
| A0A654HE93 | 587-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.