DPCstruct | MC17728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384J7I7 | 786-926 | VGLQDDLSTLEVIEAGTWDMLSASHRDMINPSAALAGLPHHGSSIPYKFPAAVELCGLGSLSDALVCRRRWDSPSVLKDRDVLLSGP… |
| E9D0B5 | 2-133 | QGDHEHLEVNDAGTWSQLSAAHRDLVPGPSSPSGHSNCYASVPYRFPTAIQLQGLEAISDALVGRARWDNPTVIEELDILFGPDEKK… |
| A0A5N6U339 | 95-215 | None |
| A0A0J6FIQ3 | 1-127 | None |
| A0A2V5IZ73 | 1-151 | None |
| A0A0E1RWU6 | 17-150 | None |
| A0A1V6TQP6 | 668-787 | None |
| B6QH26 | 76-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.