DPCstruct | MC17725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 130 ± 29 aa |
| Standard deviation of domain lengths | 28.82 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0123- PF13651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2KHD9 | 2-99 | ADIENELQYYKQHFKNKVVFCNCDDARVSNFFKYFFVHFQELGLKKLISACYVVSGSSQNSKGFYCEYEGKKDWQTTIDELNFFKGD… |
| A0A7S6MEG3 | 25-146 | KPLNRSLRAAAASKKDEFYTQLPDIEKELKHYTKHFKGKTVLCNCDDPKVSNFFHYFSHNFHKIGLKRLITTCYKNADPDLFSKHQG… |
| A0A1I5XWD1 | 63-166 | None |
| A0A5C8FW30 | 130-237 | None |
| Q50290 | 1-106 | None |
| A0A1I3KDQ9 | 1-136 | None |
| A0A1I7IFI2 | 49-243 | None |
| A0A2S0WY38 | 4-153 | None |
| A0A7V1ZFH5 | 2-138 | None |
| A0A6I0VB61 | 161-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.