DPCstruct | MC17724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6FKI4 | 27-181 | EPVEQSDITKLATQIQGLGSGVAPAEAERAAEIAYRYSLQLAQEYQVTDPPLVHNAKVIHGYRPRGLCNHWTEDLNKRLKQEHFRTL… |
| A0A7S6MC59 | 5-185 | RATAVALAVGLIAACAGCGSAPLSRDVIDADPQLRIIHAALERTVNDALASEDAAWHAGWLGNALVHVAPGDHFGLCFHWQDRVFAG… |
| A0A1F9H984 | 104-243 | None |
| A0A2V6J4Y2 | 20-191 | None |
| A0A6B2M342 | 65-206 | None |
| A0A538NPK3 | 2-144 | None |
| A0A1V0RNI4 | 4-147 | None |
| A0A2V5V5P9 | 45-202 | None |
| A0A7V3WH64 | 97-243 | None |
| A0A350F2K0 | 30-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.