DPCstruct | MC17723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L9BKA2 | 7-85 | STALNALLAAELAAGNRVHQDGDGWGTLRRLVVLERPFLALPSPLPPGLEHHTVNDPHYWQAEVLDPMTSEMLACGFDR |
| A0A290QKR0 | 6-92 | STRKEMDALPPVLRALLDAELAAGNSIAEIGHGFPAPPVGAFFKLAQPLLSRPRASGEGFTYYNRNSSLYSGEITDSKRFFFLLEPA |
| A0A848EFS3 | 5-91 | None |
| A0A3N5FG75 | 4-97 | None |
| A0A6C0GTV3 | 181-260 | None |
| A0A2U0SU36 | 191-282 | None |
| A0A1H7MWP7 | 5-83 | None |
| A0A7W9X2J5 | 16-102 | None |
| A0A1B4XD87 | 36-117 | None |
| A0A2S7DU37 | 15-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.