DPCstruct | MC17722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 272 ± 42 aa |
| Standard deviation of domain lengths | 41.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3AGJ3 | 45-338 | RSYIEGGTLAAAVWTFSGVNQVSYPDGKLPLELMVSIFRTYKGIIEEGVLGSVVVKNPRDPTKASDLITFEAKEFAVNTPPIPQNLT… |
| A0A651FEF6 | 89-329 | ERIDRGDIPPMPELTLRYKVQAGSNDPTAIYRFYFLLNGFPYPEPMGDQLRPVSAALNQFQTLSFPSFFVPDSGILELSIISERSNP… |
| A0A3L7V7S3 | 509-799 | None |
| A0A7X8YXX0 | 374-596 | None |
| A0A7T4YDA4 | 269-618 | None |
| A0A3N5R3V7 | 2-318 | None |
| A0A7V7MMI9 | 49-372 | None |
| A0A0S8E749 | 345-605 | None |
| A0A3D1T9X2 | 288-547 | None |
| A0A2D5YUN7 | 435-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.