DPCstruct | MC17721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1U664 | 179-305 | MYPGFRNFHPVRKGQPLARNQHGEIYCKETGNIFMPLYQPQGSDGFFIIRRIHPFWIRISQWLRKHRADRLLPLLPGIKRDPNQPEM… |
| A0A651F4D2 | 1-173 | MRPGFRNLDPIRSNQHLADDRDTPVHAPAFRATLIRGRPLILLPLYQRQGSDGFFIARPISRFWLALSSFLRRVNADRIAPLLPGVR… |
| A0A7Y3MK71 | 1-156 | None |
| A0A2D6QZP5 | 224-349 | None |
| A0A3M1ZUW8 | 414-555 | None |
| A0A350JMQ1 | 31-175 | None |
| A0A7Y5PZX6 | 129-272 | None |
| A0A7Y2YP49 | 71-193 | None |
| A0A316TUJ8 | 247-389 | None |
| A0A7Y2X482 | 94-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.