DPCstruct | MC1772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 284 ± 40 aa |
| Standard deviation of domain lengths | 39.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433FEM6 | 13-285 | QALSPEELSRQFGERTGDLQLSLEARTRHLRKALADIAERKRASLFESRYGPSQTAGDPAAQRILDTSPDLPASVAHHLLRQASGAE… |
| A0A7Y8E015 | 80-342 | RSDKSGDSHKYANPQASSADTLQLSLAEVMSGELPARVLEFLDEPSIRHLLGGDVPQALRVQTLRDQLADSVARQTGDIADYIHQAR… |
| A0A1I7XVM3 | 121-360 | None |
| A0A3Q9D6Q9 | 321-690 | None |
| A0A1B5F8Z0 | 55-338 | None |
| A0A560RUK5 | 57-334 | None |
| A0A0Q8C7W7 | 32-267 | None |
| A0A6A7YUQ6 | 397-634 | None |
| A0A2R7R5E0 | 2-280 | None |
| A0A136QEJ4 | 4-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.