DPCstruct | MC17719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446RHV7 | 1-159 | MRPDNEVNMALSRMQSGEHPLEALGRLTSNMSTFLKQTNILDKLPEDTLKWKMKLIKRAAQYANCRIQSVTAEVLLLASCDDNLLPS… |
| A0A452YD93 | 2-120 | LADIIPRDALLWKLKLLKSGAAYANSRLHAVQAEVLFLASGKDNLLPSGEEADRLFKGLKNCRVRYFKENGHTLLLEDGVNLLSVIK… |
| A0A446UFH4 | 76-241 | None |
| A0A287RVM4 | 134-283 | None |
| A0A7J0ELN8 | 227-366 | None |
| A0A0A9D675 | 34-169 | None |
| A0A836J9L2 | 17-158 | None |
| A0A3N7G829 | 4-141 | None |
| A0A3N7GD01 | 155-289 | None |
| A0A803KWH5 | 112-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.