DPCstruct | MC17715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061NE15 | 1-115 | MNNQAVESEMSSYVGKLLRDHFGKGPSSVYVTLKGSMFSIHLREFLAPMERVLLKQERGSKVEESRDILMEEILPEMKAMIRIQCGV… |
| A0A8B1AU15 | 52-160 | LSNEERTGIHQEIERFTEKAQKAPRNIKSVRLNERTIVSKREDILVTIEKELISSGFEEELRLSKRKLEKNIMDREYLESILNQQME… |
| A0A7V9VP31 | 7-118 | None |
| A0A4Q3W5V3 | 4-109 | None |
| A0A352DRK5 | 15-126 | None |
| B4WN66 | 9-129 | None |
| A0A7K0PAH1 | 175-286 | None |
| A0A7S7L8I7 | 8-121 | None |
| A0A5C5UNR3 | 8-121 | None |
| A0A8A7KNZ0 | 80-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.