DPCstruct | MC17712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 82.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GMV0 | 276-325 | SDFICCLYGVPGCYGVVTMPFSVREGINIFLDGFVPTENMRFRTESLSFK |
| A0A3R7HIW4 | 466-529 | SDYICVLYGTPSAYGVVTMPFSVREGINIFLSGFVPTENLRFRTEELTFKVSQNADEFGNGEGD |
| A0A556U042 | 472-560 | None |
| A0A426Y4Z9 | 140-202 | None |
| A0A0V0RWF1 | 63-135 | None |
| A0A816LTH1 | 198-273 | None |
| A0A553NBF6 | 350-447 | None |
| A0A4U5VWM1 | 254-313 | None |
| A0A2P2LVM3 | 133-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.