DPCstruct | MC17710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813YTP8 | 1-82 | MSSSQIEWDCSRCGSTPTDRRKYCTNCHSMLTWTCTGSEKSGLYANYCRHRDSCAYCTPELEEEKQQKMKEKQQQFQALDDT |
| A0A821NAI9 | 1-83 | MSSSKVKWNCSQCGSAPNDRRKYCTECHSMLTWTCTDSGKSGMYANYYHHRNNCSYCTPELEEEKQQEMEEKQQQLQTLDDSK |
| A0A820QYF1 | 1-75 | None |
| A0A814PV27 | 1-69 | None |
| A0A821GQP9 | 1-70 | None |
| A0A819ZA33 | 1-71 | None |
| A0A820SRC0 | 1-71 | None |
| A0A821BT70 | 1-73 | None |
| A0A817UY20 | 1-71 | None |
| A0A817E9M8 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.