DPCstruct | MC1771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 247 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7XLF6 | 115-338 | VARYRSSSGRELPFALDTTQRDIYRNMLSTRVIGAALSATDTHLNREYLFGSDGSVLSYSRSGSELEARLKVDLQPLNRVRADRLEN… |
| A0A433FBI9 | 1-267 | AEPQPPAQLKQLPPLPDGFHLHGVYLHSRPLPGNYPELEAWLYKNFISPLELAQCIAQFRGYALAQPSTLGASLFIRLRDEALLRYR… |
| A0A3M2VSY0 | 104-387 | None |
| A0A7T4UZR3 | 108-317 | None |
| A0A7G2MZK7 | 42-294 | None |
| A0A3M4Z3Q7 | 3-257 | None |
| A0A7T4RJU3 | 107-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.