DPCstruct | MC17709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 157 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821N538 | 1-160 | MYILLGNETIFLPAKHSWAILEKLWPAIACTKHAIKLSTQNLINCIMEKINKRFNTVAIIENTNEISKQAAIDLWRSLEKHELELYN… |
| A0A2J7R6Q3 | 335-500 | YVLLGPKQNPLVTRHDWEMLMNLWPAIVRTKPSEKLSVIRLIENIVESVHKHFPTITISLQIPELCLAAARQLWNSSPAPCFQVVSD… |
| A0A820NLT1 | 1-141 | None |
| J9EQC4 | 304-474 | None |
| A0A819LJJ1 | 731-887 | None |
| A0A3Q0JH44 | 515-682 | None |
| A0A817R8M8 | 1-140 | None |
| A0A368FD75 | 232-400 | None |
| A0A820RUR2 | 690-847 | None |
| A0A821ZZ32 | 75-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.