DPCstruct | MC17707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 147 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.12 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF04508- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H525 | 16-150 | GLCAFLLGLCIQCNDNTVMGNGKEDLCQLIEKRIGLEIYSRKLGEVSRHESYSRAGKHPQIRVNLGSDLLLDFEFCKLFKTLEHTIS… |
| A0A821MWB9 | 25-166 | ESLERLINERIDIDLFQEKLAILSKSEYYAKALQTPQLKLSKSTDMILDYKFARLYKTLEGSITHMLTRNSISSTDRTLIDPISTNL… |
| A0A1Z5L0I5 | 208-344 | None |
| A0A183RRW3 | 63-221 | None |
| A0A183KM05 | 393-550 | None |
| A0A194QVY0 | 1-118 | None |
| A0A7R9A8D7 | 550-708 | None |
| A0A5J4NC91 | 112-272 | None |
| A0A023FH59 | 124-264 | None |
| A0A7R8ZAM8 | 4-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.