DPCstruct | MC17706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 76.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452YAV9 | 4-64 | LYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGAKIIQNARLLVDKIGRPLELD |
| A0A821M540 | 1-65 | QFAYKCILNSFYGYVMRRGACWHRTEMGGIVCTTGSIIIKRTRELVEQIGRPLELDTVRYLIFQT |
| A0A1U8JS05 | 53-112 | None |
| A0A2H2IZA8 | 1-63 | None |
| A0A815RE59 | 1-64 | None |
| A0A819VWN6 | 84-144 | None |
| A0A819RPB0 | 95-155 | None |
| A0A816HGT7 | 57-118 | None |
| A0A3S5AW10 | 51-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.