DPCstruct | MC17703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 28.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821LJ50 | 2-184 | QRLQPLYDCLLTIIVNISPYLKTLSMVSSNKLLHLLEAFSSPWFLLAAPDNHHLVFFLLEAFNNLIQYQFDGNANLVYTIIRKRQVF… |
| A0A7J6TNX7 | 64-201 | TTGAESLIDMMLTSLCNISAYVRSFCLESCIKILDLLKRFSKPHWLFKGPLNHNAVFFIIENLNNVIQYQYEGNHQLVYSILRHKEV… |
| A0A4S2LTL2 | 502-655 | None |
| A0A6G0U018 | 232-392 | None |
| A0A2C6KJU4 | 232-391 | None |
| A0A5N5T6H2 | 83-209 | None |
| A0A672HVF7 | 896-1049 | None |
| A0A0R3TTV2 | 13-187 | None |
| A0A0R3Q957 | 175-321 | None |
| A0A4W5MWV7 | 56-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.