DPCstruct | MC17700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 2.56 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818PTA2 | 19-96 | LGILPALFPYGCGAIEDDSRSVQIDFREHLRYLIVFRNRRFEEHYSFIFVVFNILQHRTACFHAHLMTLIRYFQQSAQ |
| A0A821VJ79 | 50-132 | TLLLGLYPTLFPYGTGAFEDTSRPVKISFKKQIQYLFSYNDRRFEEHYSFIFIVFNMLQRREACFHARLMASKPFFSKTAEQI |
| A0A815MRJ6 | 239-318 | None |
| A0A815N517 | 1-74 | None |
| A0A821C6B5 | 1-78 | None |
| A0A821K136 | 136-215 | None |
| A0A815NP01 | 237-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.