DPCstruct | MC1770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258K6M1 | 169-221 | GGEYGFWANVNPAVAHPRWSQATEKDIATGERRPTLIYNGYGEYVAGLYAGME |
| A0A433F7P8 | 3-65 | AANEYGFYANVNPTVDHPRWTQARERRLPSGLFSPNVRETQMFNGYSDEVASLYTGLDLRKNY |
| A0A2W7QH63 | 329-387 | None |
| A0A353ZE27 | 402-460 | None |
| X1AS83 | 160-221 | None |
| A0A830HD64 | 591-655 | None |
| A0A340XE47 | 546-608 | None |
| A0A2X2T9U5 | 58-121 | None |
| A0A5C9BUT9 | 245-312 | None |
| A0A7W0S4H6 | 117-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.