DPCstruct | MC177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 188 ± 29 aa |
| Standard deviation of domain lengths | 29.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 14.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0BNW6 | 13-206 | TNLKKKVNAESWSYNMEFLLKRWAEKAAGLRFMHATTGGEWKKFSDYCSLSAIFVTIIASGASLSAASVDDQDIKDSILIGVGGVGL… |
| A0A852PNX0 | 20-181 | ETENKDKLEEELFALQFNLGRSIRYHSRRRKFFDFWDKFTTFCSLIFSSTATYGVLSTNETVTLISGAIVTILSSLSLVIGFSSKAR… |
| A0A2W6V7S1 | 1-221 | None |
| A0A538PNL7 | 9-168 | None |
| A0A6C0JY32 | 6-210 | None |
| A0A6C0JQ34 | 26-241 | None |
| C7N251 | 6-176 | None |
| A0A1Q9EBN0 | 46-206 | None |
| A0A3S1BJG7 | 5-236 | None |
| A0A535VRT2 | 17-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.