DPCstruct | MC17699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6P0G5 | 1-74 | MAMSYKVRFWEIRERTGRQKGFEVRWTVSGREKSESFRTKGLAESRRAKLMTAARHGEPFDPRSGLPASELRAL |
| A0A1I6ADZ0 | 1-90 | MSTTFDVRIWKLREKVGRRGRKSYTVRWTVAGREWSKSYATKALAESFRAKLVTAQKEEEAFRAVDGLPVSAGREVDERSWFAFAQQ… |
| A0A7W7QF85 | 1-91 | None |
| A0A8A9AL57 | 1-82 | None |
| A0A841BZ62 | 1-78 | None |
| A0A4R9EY95 | 1-79 | None |
| A0A7W3LTD6 | 21-121 | None |
| A0A7X0P6P4 | 1-80 | None |
| A0A3D5E1F2 | 14-107 | None |
| A0A4D4LBT8 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.