DPCstruct | MC17697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Standard deviation of domain lengths | 21.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H1QBH7 | 136-264 | RVLALRQGLSLMPMTDEVFDAVTDGGTEGALGFWRLPGGFEKPLARWSAAGPVAYVEAEYFGGTGEQRAAVWADGELVLGPLDAPTK… |
| A0A512M225 | 38-178 | AASSVADHLLNDRTLVAVDLRDGHRLIPLEDDDLDSLGLDLSQSLEGFTYLSPSLIQFCAEHSHHGPLVYLETEYFGGMGTQSAAAF… |
| A0A318B5K4 | 1-93 | None |
| A0A7W9STW4 | 1-152 | None |
| A0A2T0JXD4 | 11-136 | None |
| A0A222F9T6 | 13-133 | None |
| A0A542XJE4 | 48-196 | None |
| A0A1I1NQM6 | 24-172 | None |
| A0A4R2HJ24 | 1-128 | None |
| N1VUB6 | 8-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.