DPCstruct | MC17694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NZG8 | 4-84 | SSTSTGIKLDGNGYVDVVIAISSRVSQDNTLIDKIKDMVTEGSLYLFEALDKKVYFKEATILVPPQWNSKDFTRARTESFE |
| A0A6P7VA22 | 5-88 | LPFLVLAVMVSSCTTIHLDQSDGGYMNVLVGIDRSVNVDIEILNNLRVLFRKASQFLFEATRGNFYFKEVVISVPKNWPRTVSS |
| A0A498LJU0 | 8-93 | None |
| F6Q0U2 | 1-98 | None |
| A0A7M7N578 | 5-103 | None |
| A0A5A9N028 | 4-83 | None |
| A0A5B7ITW9 | 8-104 | None |
| A0A6M2CKT9 | 1-91 | None |
| A0A3B1JUK1 | 10-99 | None |
| A0A8B6CPU8 | 26-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.