DPCstruct | MC17693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 26.63 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 69.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DLF0 | 4-93 | IKEFRFYIVQLRVSDQGLQIVPNNWICEGGKFCYWPPFFSNLNIEKAVSNMVPYKDTWSRFPIKRILSAIDNYKFGIKLKEMLDGVI… |
| A0A6P7UWF9 | 2-119 | YSLVHFLAENDVAVVPTCWVCNGRAAWPPYKSNRLTMAIREREEPSTDWSTFSCQVIASCLTYEDAKYKEKNSFETGAVRTCFKQKA… |
| A0A6J1PWX2 | 2-147 | None |
| A0A182PZW8 | 287-423 | None |
| A0A0J7K301 | 4-117 | None |
| A0A0J7K600 | 10-213 | None |
| A0A0J7KKB1 | 9-121 | None |
| A0A6P8GJS0 | 24-139 | None |
| E9I9Y0 | 6-104 | None |
| A0A7J6ZMS8 | 15-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.