DPCstruct | MC17692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2S5N4 | 281-350 | ERRDAKEDEPRYEKTIKDAKAETEAEMKKNGTYGRLGSVHTFWHLLKQRLKAKGIDWRSPAELNPNTRYD |
| A0A191ZED1 | 1-73 | MDLRADPIDDDPRYAAIIAEAEQAAEAELSSIGISFGMGYCYPFWSAKKQILKERFGIDWQTPEELNPDVLFD |
| A0A1E7RLA8 | 47-116 | None |
| A0A0Q5J1H7 | 19-90 | None |
| B0CFI7 | 40-137 | None |
| A0A416RN87 | 111-186 | None |
| A0A1G1L6G8 | 10-78 | None |
| A0A316MWB4 | 201-271 | None |
| A0A117SGX9 | 7-73 | None |
| R5EQ33 | 136-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.