DPCstruct | MC17690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537PMM9 | 11-135 | MRGAQPCWKLLGAGSVGGQVLTGLPVVRALRDDPRWRDKARVWPFETGLAAQPSGALVMAEVYPSLWSVSPLAGEPKDAAQVRTVAR… |
| A0A2W7NGP4 | 165-326 | RNDIPGLPRKKPAPFPDVPERRAVETLARGSFACWQMGGTGAVGSQAMTGMACLGRLKRRFGPAISVWPFEGAEAEVVIVEMWPTLL… |
| A0A7Y7DPA9 | 19-139 | None |
| A0A6L7LY51 | 4-143 | None |
| A0A1I3L534 | 149-286 | None |
| A0A2E9Y339 | 117-245 | None |
| A0A839YP22 | 6-121 | None |
| A0A0K1PG82 | 1-105 | None |
| B9KLT0 | 316-451 | None |
| A0A1Y1IB83 | 298-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.