DPCstruct | MC17689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3F0X0 | 1-65 | MTSENSPDGRFCVDIFQRADGTWGFEQYRRDVEDGFWFPVSRYSALVFPDAVTARARAVAEIDWF |
| A0A2E1RX92 | 16-87 | RQKPIVVTSIEHDSGLYCVDILEFPSHRFGFREFRRDPEDPHGWRPTGLAHDCTLKSAALALLKAKGVIGWL |
| A0A177Q5Z2 | 2-77 | None |
| A0A2V6SKN7 | 3-57 | None |
| A0A1F9SHG4 | 16-97 | None |
| C3BLN2 | 27-99 | None |
| A0A521ZMW1 | 13-92 | None |
| A0A7W6MAE9 | 2-73 | None |
| A0A120GBJ9 | 26-107 | None |
| A0A1M5NN80 | 5-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.