DPCstruct | MC17688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0FCP8 | 3-109 | NYFAEIDSSNVVLRVIVCDTKEWCENSLGGTWVQTYRDDSSKNPAGRGMIYHADKENFSSTQPYPSWVLDNNCDWQPPTPMPDLTQE… |
| A0A2E0E7P1 | 1-108 | MNYYFFLDLNNIIDQVVCNDDTEDLTSQYSQLRNQRCIKRSNAENLPGIGYTYMDDLEAFVEPQPFPSWTLNVETKEWQAPAVKPDD… |
| A0A3N5QBT2 | 2-99 | None |
| A0A2E0M551 | 2-107 | None |
| A0A2E1JEZ5 | 1-87 | None |
| A0A1Z8W6S6 | 2-92 | None |
| A0A2E2A058 | 1-103 | None |
| A0A2A4MDY2 | 1-97 | None |
| A0A2D6FN66 | 1-123 | None |
| A0A383B1D6 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.