DPCstruct | MC1768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7PN73 | 2-87 | EEMFWYIVAQAPPEVPRGPDFGKASPIGLLLLVLLAVVVLSIGYAFHRRFSRFRRRQMFAEAHGIDPFDEEAINQAMAEAGVLDQR |
| A0A2W5L865 | 2-71 | HEGPMGPEFGKASPIGLLVIVSLAVAIMVLGWSFHRRQSKFRRRRAFAEDHGLDPFDVEAVEAAMREAGV |
| A0A7T4JFN4 | 16-102 | None |
| A0A0X2NKF9 | 17-97 | None |
| A0A0M2XN08 | 6-80 | None |
| C4LHN1 | 32-114 | None |
| A0A5D4FXI5 | 25-112 | None |
| A0A1Q9VYD8 | 4-85 | None |
| A0A381KDN2 | 5-91 | None |
| A0A376C9M6 | 10-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.