DPCstruct | MC17679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9EBX0 | 48-166 | VHLDETKEQDEKIMHYQRLKSAGKIDSYGQQQVKQLLQNVQRVLLPITVRNPYAELLQLPPSVFKPRRTNAHYLAFIEVITFYHQYQ… |
| A0A843KPM4 | 1-124 | MLTVWIGDTIDQDDRAFTHMKAAEAACRYPENDDILTCRAIWEAIKTDVLPVWIPFARRIQSSATQNRRNPAMLFDLIKCHARLFSL… |
| A0A1V5Z4E9 | 7-110 | None |
| A0A1V5Z741 | 97-210 | None |
| A0A1V5A9N4 | 533-662 | None |
| U6EBK3 | 345-468 | None |
| A0A2D6QY28 | 5-120 | None |
| A0A7J3MNX7 | 4-136 | None |
| A0A5C5ZIM3 | 531-652 | None |
| A0A151F0G3 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.