DPCstruct | MC17678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4U5V3 | 193-263 | ICLHCYQEAVERARASAPPLSGVIDYARMEPVTSSIGRCSVCGLEKAEWIDRGSGVRLCGECFRRGQANTT |
| A0A843KPA0 | 1-83 | MKRGGRLYLCYDRLKKAKQPAKVQPLPGALDHRTFVRTTVEPGRCDVCAEKKAVYRSREARTNIGEGCYARLVREWNGRKGVR |
| A0A1V5S6K2 | 240-310 | None |
| A0A1V5ZC25 | 26-114 | None |
| A0A1V5Z741 | 598-651 | None |
| A0A1V5SMZ3 | 1-83 | None |
| A0A1V4UCG2 | 302-368 | None |
| A0A7K3Y7H6 | 1-63 | None |
| Q2FTE9 | 616-684 | None |
| A0A0X3BKN1 | 492-563 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.