DPCstruct | MC17676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 160 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 48.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1BSK4 | 1-166 | YPTVAESHFGGSVRACCAAAGCGSAVACATGLAQPTLSAWSMSMLGHYERVGRLGFYGYDLQDQCTACGSYSYQSDEGMPFEMRGVN… |
| A0A831PDS6 | 1-137 | SIGTGNSNAGLNGWYLSMLMHKEGWSRLGFFGYDLQDQCGSANSLSMEPDRGLMGELRGPNYPNYAMNVGHQGEYAAIVGGAHYGRN… |
| A0A257ACQ6 | 309-471 | None |
| A0A842Y3G2 | 410-573 | None |
| A0A1V4ULS6 | 161-323 | None |
| A0A850LXH7 | 138-299 | None |
| A0A811TKZ5 | 187-350 | None |
| A0A497ISH3 | 523-684 | None |
| A0A7L4QH32 | 79-238 | None |
| A0A843IX31 | 270-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.