DPCstruct | MC17675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 3.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5X0Z2 | 1-65 | QGYDPVNPFKNGLPDEAHWRVHMRADIALLLACDYIYMLKDWELSKGAKLELDVASSCGIKVLFE |
| A0A806UV46 | 23-85 | GYEVINPAELNADPSAGWLDCMRTDIKHLVDCDAIAMLEGWQTSRGASLEYTIALTLGHAVFR |
| A0A7R7YGL7 | 95-158 | None |
| A0A3N0ZBN1 | 134-191 | None |
| A0A0G1W3R0 | 43-100 | None |
| A0A7I9SHZ7 | 1-67 | None |
| E5VKF3 | 2-67 | None |
| A0A1I1XQ45 | 35-94 | None |
| A0A7D5NJ10 | 134-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.