DPCstruct | MC17674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3WIR7 | 125-202 | SVIVWKCKVCGYEYVGDNPPDKCPKCGSAKTLFEKKETEPVVETIWECGLCGYEHTGDNPPDKCPKCGAAKALFKKKS |
| A0A5C9F0C3 | 159-241 | SFWECQGCGFKISIYELPEDWICPSCGQLASYFQKKYFNLIYEEHVIWKCMECGDEVSLQTLPDSWRCLSCGKKKPYFKRKAT |
| A0A0G1U601 | 1-94 | None |
| U4SZQ7 | 480-570 | None |
| A0A355TQR8 | 173-280 | None |
| A0A256WL27 | 2-78 | None |
| A0A842RRK5 | 203-296 | None |
| A0A7X6TY68 | 1-79 | None |
| A0A7X5W0N1 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.