DPCstruct | MC17672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 636 |
|---|---|
| Mean domain length (aa) | 191 ± 37 aa |
| Standard deviation of domain lengths | 36.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.97 |
| Pfam Score | 89.66 |
| Assigned Pfam label(s) | CL0052- CL0137- CL0020- PF09894- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5RSC8 | 2-170 | AGAGAVATQSYANVSYGPRGLDLMAAGVSAQEALEQLLADDPDRELRQVGIVDGRGGAATFTGSGCHAWAGGRTGPGYAAQGNILAG… |
| R1FWA3 | 4-190 | LIGFTGKDYAIIAADANAARSIMVYSQQLDKIRELDSHKLLAVGGDAADCIQEPEYIQKNMTLYAMRNGVQLTTHAAANYIRGEKSY… |
| A0A4V1K010 | 1-221 | None |
| A0A538PZJ9 | 1-241 | None |
| A0A5B7D9U2 | 638-768 | None |
| A0A418WUZ3 | 58-253 | None |
| A0A7S1UK49 | 7-146 | None |
| A0A6T7Y1L1 | 42-280 | None |
| A0A7V3AC41 | 22-241 | None |
| A0A6D2HGP5 | 12-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.