DPCstruct | MC17671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3MM88 | 78-161 | NPAWLSLMLELTRVVCLTHRRFNADDVMDLYDAIEHAPTTPEARAMGPVLQKAAKAGYCKKTKLTEKSRRKGSRGRSLTMWESL |
| A0A2D5YES2 | 1-117 | MSGQQERDRGMAIAETYAKPSQKLAVKQAIKRCYQKFNVHVEWTSDEVHEELKAAGVILENGRLLGPLMKRAQRAGMIEPVVCMLCH… |
| A0A212J3M0 | 59-183 | None |
| A0A518K1V1 | 1-80 | None |
| A0A0C6FV75 | 8-103 | None |
| A0A0M9XRF8 | 24-102 | None |
| A0A0S7ZAF6 | 23-130 | None |
| A0A1E8CGA4 | 11-108 | None |
| A0A0H3WS89 | 124-225 | None |
| A0A2E8JSD4 | 30-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.