DPCstruct | MC1767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 179 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397S087 | 105-282 | RIAYSLFNSAKIIQRAWRAFKLRPETWVKRVWNMVRNDGTPDRKKYLGIFSLVERRINPQNQEEYDLYIDEYVNCLKKAFNKNLAQK… |
| A0A2P4QU22 | 1-149 | MKRSWGFLIARQYNYQFENFYATVIQQAYRNYKKRPESLAKKVWEIVRNDATPNDKKFLGMKNEWGYHPSGQIWYDDYCFSVKNDWI… |
| A0A372QTI9 | 71-214 | None |
| A0A2H5T0X8 | 146-343 | None |
| A0A2H5SSP9 | 733-969 | None |
| A0A2Z6RIR9 | 1-185 | None |
| A0A2Z6RHH1 | 1-158 | None |
| A0A2Z6RDZ5 | 160-337 | None |
| A0A2Z6R669 | 8-195 | None |
| A0A372Q6G7 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.