DPCstruct | MC17667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 327 ± 34 aa |
| Standard deviation of domain lengths | 33.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4K8J9 | 505-810 | SQGYKLIEGLIVNTQGGGGVGFRTHAVPDRERKRYGASWEETLLWVTPETVCVPNNVSMRVTTNDEGGSTSLLVDTGGFGGLAGAQD… |
| A0A084G9L5 | 234-583 | DSYKAVEGLVVNGKEGGIGFRNHTIPTGLARGASWKEDLLFVEPVTACVDTNLTFDFTISSAITFNTSNFIDFRLTDRGGFVNLVHE… |
| A0A166N2T0 | 1-274 | None |
| A0A0J9W128 | 3-291 | None |
| F2SQI9 | 230-525 | None |
| A0A6A6ZE52 | 220-583 | None |
| A0A0D2B178 | 83-426 | None |
| A0A2C5Z693 | 239-600 | None |
| A0A1S9DJT4 | 567-926 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.