DPCstruct | MC17666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 232 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1B167 | 9-268 | KEARKAFLWLLREETTHDLSDRISAIDVVALLPKGKVSAEARYRRLKECLLKGSDEVRRNREETRTLFSATHFAALFRYACDHFSQA… |
| A0A084QWX7 | 1-237 | MFDYVSAIDIVQLTPGRSRFDQLKNRLLASSDEARANKENARALFSITHFAAFLNDACAHFCKHQEPFDFIKSSRKDNPVSSDLEQH… |
| W9NEU8 | 1-227 | None |
| A0A7J6JCU1 | 478-728 | None |
| A0A4U0XSE0 | 186-439 | None |
| A0A399G7H0 | 1-215 | None |
| X0H1J6 | 3-216 | None |
| X0GYQ2 | 100-323 | None |
| A0A2U3DPT9 | 76-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.