DPCstruct | MC17665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 138 ± 24 aa |
| Standard deviation of domain lengths | 24.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6R4Q1 | 7-147 | SPALASKIATMRLKICPIVSVMCGQASEHFPGTMLEFWLLTEAQLDGMAHFYSQSTPDEFTNLYPRPMKWDKDFLSTATPKAMSSRE… |
| A0A084QJM8 | 6-137 | MLSRTPRPRRNSKSLVFELKLRQMQMRVSPLVRLDTGTVHPDFPTTMLHFWLLTEHQLDSLAYYYHQAAPNPFWAMYPYPICWDFSM… |
| F0XMX6 | 10-107 | None |
| A0A2N1L1M2 | 2-112 | None |
| A0A6A5VEY5 | 1-132 | None |
| C8VMF1 | 239-385 | None |
| A0A401L078 | 118-285 | None |
| A0A225AIJ6 | 15-140 | None |
| A0A0A1T8Q0 | 59-215 | None |
| A0A0F8A680 | 33-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.