DPCstruct | MC17656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0S4L4 | 10-172 | DELLQTAETVLAYQRSSGGWPKNYDREEQLSESRLQELRAARDQRDSTIDNGATHREIRILAAAYKQSGDMRYLNSASRGIQYLIDA… |
| A0A5C5YG57 | 20-188 | LIVAGKSADAQIRFDKNLLRNDDAWFQSDVAREVADNVIQYQSPQGGWPKSTDLAKPPRSPDDIPRPGDGRANSLDNDATTVPMQFL… |
| A0A255S8E1 | 1-204 | None |
| A0A519SNA4 | 3-129 | None |
| A0A1Y4DC14 | 23-171 | None |
| Q02A34 | 230-390 | None |
| A0A7C6C644 | 15-184 | None |
| W4QBT2 | 443-624 | None |
| A0A517TYR2 | 642-797 | None |
| A0A7Y4UGY3 | 311-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.