DPCstruct | MC17651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510UMF2 | 217-401 | WKINNTVVARQHLLYLPKKMTTQQFEELTAKWLDEHACLLDIDAIVRTKDEKKLAREKKNGNQIIYIIQSGDTLSIIAEQQGLTLSE… |
| A0A061PTZ3 | 34-237 | FNTILVRVAIEGKKAAPQHIFYRQEKLTNDELAEINPTWLEQNATLIDIAALKAIVKQSLLPRENTATQSNNETSKAKTHKVSTNDD… |
| A0A812FEF5 | 202-386 | None |
| A0A7Y4FAI0 | 1-218 | None |
| A0A7Y4FAI6 | 5-200 | None |
| A0A1R4B100 | 264-458 | None |
| A0A1Y6IWE4 | 199-391 | None |
| A0A1P8MCN1 | 225-445 | None |
| A0A7U4CP96 | 267-499 | None |
| A0A7X4LPG0 | 303-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.