DPCstruct | MC17650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 454 ± 95 aa |
| Standard deviation of domain lengths | 94.88 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 85.27 |
| Assigned Pfam label(s) | PF00773- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366MNW3 | 146-599 | IIDNKEFEEIKFIGNLDEPKIDEFISLYLNGENYRDEIKIEPEALMNDEKQRVDLTTLPFCTIDPNSAKDHDDAIYYDVENETLYVA… |
| A0A2E0I5T4 | 2-460 | DEVNKFSSKVSPLDFKGRKDLRDLALVTIDGETARDFDDAVFAEPDGDNWRLVVAIADVSAYVKPSSKLDTSAADRGNSVYFPRRVI… |
| S7WLJ5 | 2-416 | None |
| A0A2V2XG70 | 237-674 | None |
| A0A453PMW6 | 202-718 | None |
| A0A2T7P6D4 | 2-337 | None |
| A0A2G8LC84 | 575-1061 | None |
| A0A8B6DB46 | 666-1162 | None |
| A0A4S4EV27 | 285-829 | None |
| A0A1R3J9R5 | 158-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.