DPCstruct | MC1765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 259 ± 45 aa |
| Standard deviation of domain lengths | 44.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4QJB6 | 23-297 | VNKRFLTGVQLLQQYECNVFDSIVPKLLQNWPDIFVGKFEFITSIIHGINPMLIYKFETDLRLGHYKVFGNIDLDYVLEHSLNCWGS… |
| A0A7J7SQY8 | 3-222 | VAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLEWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRRE… |
| A0A6P4EMV3 | 462-737 | None |
| A0A6I9Z0V9 | 573-831 | None |
| A0A7R9AQ50 | 22-434 | None |
| A0A4P9Y224 | 593-928 | None |
| A0A662WVC1 | 219-491 | None |
| T1PID2 | 226-501 | None |
| A0A2I0L946 | 22-205 | None |
| A0A418AW31 | 177-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.