DPCstruct | MC17648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 223 ± 32 aa |
| Standard deviation of domain lengths | 32.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07958 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0B912 | 1-203 | MTPDIEYLLSLEAVRERSRIVFEAAEKDELSHFTYHASKLPEAAAYVTSVINRDFGPDNFDAIPPHGRWQHFNVGGVPRIDDLNKQW… |
| A0A292PM90 | 210-424 | PDPGLDPSGYLRSIYAVRERSKFVIEAALRNQLTNFTVDMTKFRDVAEYVVSIIKRDHAPDYHMIPPHGRWQHFEVGGRPRIDQMMQ… |
| A0A5N5QNC4 | 595-802 | None |
| A0A2E6X7Z2 | 6-220 | None |
| A0A367KMF0 | 5-214 | None |
| A0A421G945 | 9-271 | None |
| L2G5U2 | 1-215 | None |
| T5C2H4 | 192-409 | None |
| A0A3M7M0U2 | 324-586 | None |
| A0A1R0H3D6 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.